Sinocyclocheilus grahami (golden-line barbel): 107587043
Help
Entry
107587043 CDS
T04918
Name
(RefSeq) cytochrome b-c1 complex subunit Rieske, mitochondrial-like
KO
K00411
ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:
7.1.1.8
]
Organism
sgh
Sinocyclocheilus grahami (golden-line barbel)
Pathway
sgh00190
Oxidative phosphorylation
sgh01100
Metabolic pathways
sgh04148
Efferocytosis
sgh04260
Cardiac muscle contraction
Module
sgh_M00151
Cytochrome bc1 complex respiratory unit
sgh_M00152
Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:
sgh00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
107587043
09140 Cellular Processes
09141 Transport and catabolism
04148 Efferocytosis
107587043
09150 Organismal Systems
09153 Circulatory system
04260 Cardiac muscle contraction
107587043
Enzymes [BR:
sgh01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.8 quinol---cytochrome-c reductase
107587043
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Rieske
UCR_TM
Motif
Other DBs
NCBI-GeneID:
107587043
NCBI-ProteinID:
XP_016130134
LinkDB
All DBs
Position
Unknown
AA seq
146 aa
AA seq
DB search
FRHYTVTHFVSSMSASADVLALSKIEIKLSDIPEGKNMTFKWRGKPLFVRHRTEEITAEQ
NIDLSELWDPQHDKDRITNPTWVIVTGVCTHLGCVPITNAGDYGRYYCPCHGSHYDASGR
IRKGLAPLNLEVPYYEFPDEDTVIVG
NT seq
441 nt
NT seq
+upstream
nt +downstream
nt
tttcggcactacaccgtgacccatttcgtgtcctcaatgagtgcctctgctgacgtcctg
gccctgtccaaaatcgagataaagttgtctgacatcccagaggggaaaaacatgaccttc
aagtggagaggcaagcctctgtttgttcgtcacagaacagaggagatcacagccgagcag
aacattgatctttcagagctctgggacccccagcatgacaaagaccgcatcaccaacccc
acctgggtcatcgtcactggtgtctgcactcatctcggctgtgtcccaatcacaaatgcc
ggtgattacggcaggtactactgcccctgccatgggtcacattacgatgcttcaggaagg
atcagaaaaggactcgcacctctcaacttggaggtgccttattatgagtttcctgatgag
gatactgtaattgttggataa
DBGET
integrated database retrieval system