Sphingopyxis granuli: SGRAN_1709 Help Entry SGRAN_1709        CDS       T04372                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism sgi  Sphingopyxis granuli Pathway sgi01100   Metabolic pathways sgi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SGRAN_1709 (acpP)    00074 Mycolic acid biosynthesis     SGRAN_1709 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SGRAN_1709 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  AMG74089 UniProt:  A0AA86GKY7 LinkDB All DBs Position 1874231..1874467 Genome browser AA seq 78 aa AA seqDB search MSDSAEKVKKIVVEHLGVEADKVTEEASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKIATVKDAIDYIEANKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgattcggccgaaaaggttaagaagatcgtcgtcgagcatctgggcgtcgaagcc gacaaagtcaccgaggaagcgagcttcatcgacgatctgggcgccgacagtctcgatatc gtcgaactggtgatggcgttcgaggaagaattcggcgtcgagattcccgacgatgcggcg gaaaagatcgccaccgtcaaggatgcgatcgactatatcgaagcgaacaagggctag

DBGET integrated database retrieval system