Sphingopyxis granuli: SGRAN_2265 Help Entry SGRAN_2265        CDS       T04372                                  Symbol atpE Name (GenBank) ATP synthase subunit c   KO K02110   F-type H+-transporting ATPase subunit c Organism sgi  Sphingopyxis granuli Pathway sgi00190   Oxidative phosphorylation sgi01100   Metabolic pathways Module sgi_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sgi00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     SGRAN_2265 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sgi00194]     SGRAN_2265 (atpE) Photosynthesis proteins [BR:sgi00194]  Photosystem and electron transport system   F-type ATPase [OT]    SGRAN_2265 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AMG74631 UniProt:  A0AA86L389 LinkDB All DBs Position complement(2464260..2464490) Genome browser AA seq 76 aa AA seqDB search MDAQAATLIGAGLAAIGAGMAAIGVGNVFGSFLESALRNPAAADGQQGRLFIGFAAAELL GLLSFLIAILLYLKAA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggacgcacaagcagcgacgctcatcggtgccggtctcgccgcgatcggcgccggcatg gccgcgatcggcgtgggcaatgtcttcggcagcttcctggaaagcgcgctgcgcaatccg gcggcggccgacggtcagcagggccgcctgttcatcggcttcgccgcggcggagcttctg ggcctgctgtcgttcctgatcgcgatcctgctctatctgaaggcggcctga

DBGET integrated database retrieval system