Streptomyces genisteinicus: IAG43_17215 Help Entry IAG43_17215       CDS       T07903                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sgj  Streptomyces genisteinicus Pathway sgj00998   Biosynthesis of various antibiotics sgj01100   Metabolic pathways sgj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IAG43_17215    00074 Mycolic acid biosynthesis     IAG43_17215   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IAG43_17215 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Baseplate_J_C ACP_SdgA_C Fas_alpha_ACP Motif Other DBs NCBI-ProteinID:  QNP64479 UniProt:  A0A7H0HVB3 LinkDB All DBs Position 3968605..3968862 Genome browser AA seq 85 aa AA seqDB search MAATIAERQETIKEIVCDILEIDPEEVTGTSLFKEDHDADSLRAIEILASLEKEFGAVIN QSELGRMVNLEGVYDVVAEAAGWKL NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtggctgccaccattgctgagcgccaggagaccatcaaggaaatcgtgtgcgacatcctg gagatcgacccggaggaggtgacggggacgagcctcttcaaggaggaccacgacgcggac tcgctgcgcgctatcgagatcctggcctctctggaaaaggagttcggcgccgtcatcaac cagtccgagctcggccggatggtcaatctcgaaggcgtctacgacgtggtggccgaggcc gccggctggaagctctga

DBGET integrated database retrieval system