Streptomyces genisteinicus: IAG43_21900 Help Entry IAG43_21900       CDS       T07903                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism sgj  Streptomyces genisteinicus Pathway sgj00190   Oxidative phosphorylation sgj01100   Metabolic pathways Module sgj_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sgj00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     IAG43_21900 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sgj00194]     IAG43_21900 (atpE) Photosynthesis proteins [BR:sgj00194]  Photosystem and electron transport system   F-type ATPase [OT]    IAG43_21900 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QNP65314 UniProt:  A0A7H0HXP8 LinkDB All DBs Position 4999560..4999796 Genome browser AA seq 78 aa AA seqDB search MAATETLAQVTGSLGSIGYGLAAIGPGIGVGIVFGNGTQALARQPEAAGLIRANQILGFA FCEALALIGIVMPFVFGQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctgccactgagacccttgcccaggtcaccggttcgctcggctccatcggctacggc ctcgccgcgatcggccccggcatcggcgtcggcatcgtcttcggcaacggcacccaggct ctggcccgtcagcccgaggctgccggcctgatccgtgccaaccagatcctgggcttcgcc ttctgtgaggcgctcgccctgatcggcatcgttatgccgttcgtgttcggtcagtaa

DBGET integrated database retrieval system