Streptomyces genisteinicus: IAG43_29415 Help Entry IAG43_29415       CDS       T07903                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sgj  Streptomyces genisteinicus Pathway sgj00261   Monobactam biosynthesis sgj01100   Metabolic pathways sgj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgj00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     IAG43_29415  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sgj01008]     IAG43_29415 Polyketide biosynthesis proteins [BR:sgj01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     IAG43_29415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QNP66635 UniProt:  A0A7H0I1G9 LinkDB All DBs Position 6867818..6868036 Genome browser AA seq 72 aa AA seqDB search MSNPFEDTDGTYVVLVNDEGQHSLWPEDIDVPGGWTTVHGPAGHASCVEYVEENWADMRP RSLAEAMDRPRP NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgagcaacccgttcgaggacaccgacggcacctatgtcgttctggtcaacgacgagggg cagcactcgctgtggcccgaggacatcgacgtgccgggtggctggacgacggtgcacggg ccggcgggacacgcctcgtgcgtggagtacgtcgaggagaactgggcggacatgcgtccg cggagtctcgccgaggccatggaccggccgcggccctga

DBGET integrated database retrieval system