Sodalis glossinidius: SG0305 Help Entry SG0305            CDS       T00316                                  Name (GenBank) chaperonin GroES   KO K04078   chaperonin GroES Organism sgl  Sodalis glossinidius Brite KEGG Orthology (KO) [BR:sgl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:sgl03110]     SG0305    03029 Mitochondrial biogenesis [BR:sgl03029]     SG0305 Chaperones and folding catalysts [BR:sgl03110]  Heat shock proteins   HSP10    SG0305 Mitochondrial biogenesis [BR:sgl03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     SG0305 SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 DUF7205 MazE_antitoxin Motif Other DBs NCBI-ProteinID:  BAE73580 UniProt:  Q2NW95 LinkDB All DBs Position 551473..551766 Genome browser AA seq 97 aa AA seqDB search MKIRPLHDRVIVKRKEIEAKSAGGIVLTGSAAGKSTRGEVLAVGRGRILENGEVKALDVK VGDIVIFNDGYGVKVEKIDNDEVLIMSESDILAIVEK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaaaattcgtccattacatgatcgcgttatcgttaagcgtaaagaaatcgaagccaaa tctgcgggcggcatcgtgctgaccggttccgcggcgggcaagtccactcgcggtgaagta ctggctgtgggccgtggccgtatcctggaaaacggcgaagtgaaagcgctggacgtgaag gtaggcgacatcgtgattttcaatgacggatatggcgtgaaggttgagaaaatcgacaac gatgaagtgctgatcatgtccgaaagcgacatcctggctatcgttgagaagtaa

DBGET integrated database retrieval system