Sodalis glossinidius: SG1061 Help Entry SG1061            CDS       T00316                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sgl  Sodalis glossinidius Pathway sgl01100   Metabolic pathways sgl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SG1061    00074 Mycolic acid biosynthesis     SG1061   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SG1061 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Motif Other DBs NCBI-ProteinID:  BAE74336 UniProt:  Q2NU39 A0A193QID7 LinkDB All DBs Position 1764096..1764332 Genome browser AA seq 78 aa AA seqDB search MSTIEESVKAIIAEQLGVKKEEVVNNASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFIQASQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaaagcgttaaggcaatcattgctgagcaactgggcgttaagaaa gaagaagtcgttaataatgcttctttcgttgacgacctcggcgctgactctcttgacacc gttgagctggttatggcgctggaagaagagttcgataccgaaattccggacgaggaagct gaaaaaatcactactgttcaggcagcaattgattttattcaggcaagccagcagtaa

DBGET integrated database retrieval system