KEGG   Shewanella glacialimarina: FJ709_18445
Entry
FJ709_18445       CDS       T07885                                 
Name
(GenBank) chemotaxis response regulator protein-glutamate methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
sgla  Shewanella glacialimarina
Pathway
sgla02020  Two-component system
sgla02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sgla00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    FJ709_18445
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    FJ709_18445
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sgla02022]
    FJ709_18445
   02035 Bacterial motility proteins [BR:sgla02035]
    FJ709_18445
Enzymes [BR:sgla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     FJ709_18445
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     FJ709_18445
Two-component system [BR:sgla02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   FJ709_18445
Bacterial motility proteins [BR:sgla02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    FJ709_18445
SSDB
Motif
Pfam: CheB_methylest Response_reg
Other DBs
NCBI-ProteinID: UCX06304
LinkDB
Position
4226919..4227950
AA seq 343 aa
MIKVLVIDDSALMRQRLTQMLDTDDNIIVVGEAEDPYEARELIKQLSPDVLTLDVDMLKM
DGLAFLRNLMRLRPMPVLMVSSLTKKAADITLEALSLGAIDYIVKPQNHYQNSLSLFQNN
LVQKVTAAGQVSFDAPPAIRHHHAIAPPVTGKFKNGLIAIGASTGGIEAIQTILMALPAN
MPPIVITQHIQPVFSSSFVARLNQNCHLNVIEAQGGEKLTAGNVYIAPGDQHLAIEPEGN
HFKTKLLNTGPVNRHKPSIDVLFNSVAEHAAQNSVGIILTGMGADGSTGLLAMKQKGAYT
IAQDEASSLVWQMPSAAVAIEAASEVLPLTQISDKLLTLLTIS
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgattaaagtattggtcatagatgattctgccttaatgcgccagcgactcactcagatg
cttgatactgatgataatattattgttgtgggtgaagcagaagatccctatgaagctcgc
gaacttattaaacaactttcacctgatgtgttaacccttgatgttgacatgctaaaaatg
gatgggctggcttttttgcgtaatttaatgcgcctaagacccatgccagtcttgatggtg
tcttcgctcactaaaaaggcagccgacatcaccttagaagcactctctttgggggctata
gattatattgttaagccacaaaaccattatcaaaatagcctatcattatttcaaaataat
ttagttcaaaaagtcaccgctgcaggacaagtgtcctttgatgcaccaccggctattcgc
catcatcatgcaatagctcccccagtgacggggaagtttaaaaatggacttatcgccata
ggggcgtcaacaggaggcattgaagcgattcaaaccattctgatggcattacccgcaaat
atgccacccattgtgattacccagcatatacagccagtatttagcagctcatttgtagct
aggctaaatcaaaattgccacttaaatgtgatagaagcccaaggtggtgaaaagctcacc
gcaggtaacgtttatattgccccaggggatcagcatttagccatcgaacctgaaggcaac
cactttaaaacaaaactacttaacactgggccagtaaaccgccataaaccctcgatagac
gtattatttaatagcgtcgctgaacatgcggctcaaaactctgttggtattatactgacc
ggaatgggcgccgatggcagcacaggcctacttgcaatgaaacaaaaaggggcttatacc
atagcacaagatgaagcttcgtcgttggtgtggcaaatgcccagtgccgcggttgccatt
gaggcagccagtgaagtattacctctaactcaaattagcgacaaactactgaccttactc
accatcagttaa

DBGET integrated database retrieval system