Sphingomonas glaciei: M1K48_05860 Help Entry M1K48_05860       CDS       T08593                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sglc  Sphingomonas glaciei Pathway sglc01100   Metabolic pathways sglc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sglc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M1K48_05860    00074 Mycolic acid biosynthesis     M1K48_05860   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M1K48_05860 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Ribosomal_L50 DUF5783 DUF1493 HLH Motif Other DBs NCBI-ProteinID:  UUR09139 UniProt:  A0ABY5N082 LinkDB All DBs Position complement(1203395..1203631) Genome browser AA seq 78 aa AA seqDB search MSETAERVKKIVVEHLGVEAEKVTEEASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKITTVKDAIDYIDQHQS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgagaccgctgaacgggtgaagaagatcgttgtcgagcacctcggtgtcgaagcc gagaaggtgacggaagaggcgagcttcatcgacgatctcggcgccgacagcctcgacatc gtcgagctggtgatggcgttcgaggaagagttcggagttgaaattcccgacgacgcggcg gagaagatcaccaccgtcaaggatgcgatcgactacatcgaccagcatcagagctga

DBGET integrated database retrieval system