KEGG   Sphingomonas glaciei: M1K48_06490
Entry
M1K48_06490       CDS       T08593                                 
Symbol
petA
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
sglc  Sphingomonas glaciei
Pathway
sglc00190  Oxidative phosphorylation
sglc01100  Metabolic pathways
sglc02020  Two-component system
sglc04148  Efferocytosis
Module
sglc_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:sglc00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    M1K48_06490 (petA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    M1K48_06490 (petA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    M1K48_06490 (petA)
Enzymes [BR:sglc01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     M1K48_06490 (petA)
SSDB
Motif
Pfam: Rieske UCR_Fe-S_N
Other DBs
NCBI-ProteinID: UUR09436
UniProt: A0ABY5N4F5
LinkDB
Position
complement(1311933..1312490)
AA seq 185 aa
MPGEPSAAEAGDPGVRRRDFINIAAVSFAGVGAVTAIAPLLMQAAPSADVRALSSIEVDI
SKIQPGQGIKTSWRKQPVFIKQLTPQEVQAANDVSVSELRDPQSLADRTKPGKSQWLVTL
GVCTHLGCVPLGIGEGETKGDFGGYFCPCHGSHYDTAARIRKGPAPTNLAVPDYEFASDT
VVRIG
NT seq 558 nt   +upstreamnt  +downstreamnt
atgcccggcgagccaagcgcggccgaggccggcgacccgggcgtgcgtcgccgcgacttc
atcaatatcgccgcggtaagcttcgccggggtcggcgcggtcaccgcgatcgccccgctg
ctgatgcaggccgcgccgtcggccgacgtccgcgcactgtcgtcgatcgaagtcgacatc
tccaagatccagccgggtcagggcatcaagaccagctggcgcaagcagccggtgttcatc
aagcagctgaccccgcaggaggttcaggccgccaatgacgtgtcggtcagcgagcttcgc
gatccgcagagccttgccgaccgcaccaagcccggcaagagccagtggttggtgacgttg
ggcgtctgcacccacctcggctgcgtgccgctcggcatcggcgagggggagaccaagggt
gacttcggcggctatttctgcccgtgccacgggtcgcactatgacactgcggcacgcatt
cgtaagggcccggcgccgaccaatctggccgtgcctgactatgaattcgctagcgacacc
gttgtccggatcggttga

DBGET integrated database retrieval system