Streptomyces glycanivorans: P8A20_11375 Help Entry P8A20_11375       CDS       T10510                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism sgly  Streptomyces glycanivorans Pathway sgly00190   Oxidative phosphorylation sgly01100   Metabolic pathways Module sgly_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sgly00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     P8A20_11375 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sgly00194]     P8A20_11375 (atpE) Photosynthesis proteins [BR:sgly00194]  Photosystem and electron transport system   F-type ATPase [OT]    P8A20_11375 (atpE) SSDB OrthologParalogGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  WLQ64153 UniProt:  A0ABY9JCT9 LinkDB All DBs Position complement(2701278..2701523) Genome browser AA seq 81 aa AA seqDB search MSALETLAAVNITGNLGSIGYGLAAIGPGVGVGIIFGNGTQALARQPEAAGLIRSNQILG FVLCEALALIGLVMPFVYPVD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgtccgctcttgagaccctcgccgccgtcaacatcacgggcaacctcggttccatcggc tacggcctcgccgcgatcggccccggcgtcggcgtcggcatcatcttcggtaacggcacc caggcgctggcccgtcagcccgaagctgccggcctgatccgctcgaaccagatcctcggc ttcgtgctctgtgaggcgctcgccctgatcggtctcgtcatgcccttcgtctacccggtc gactaa

DBGET integrated database retrieval system