Streptomyces glycanivorans: P8A20_25670 Help Entry P8A20_25670       CDS       T10510                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sgly  Streptomyces glycanivorans Pathway sgly00998   Biosynthesis of various antibiotics sgly01100   Metabolic pathways sgly01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgly00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     P8A20_25670    00074 Mycolic acid biosynthesis     P8A20_25670   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     P8A20_25670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  WLQ66752 LinkDB All DBs Position complement(5842755..5843003) Genome browser AA seq 82 aa AA seqDB search MAATQEEIVTGLAEIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDAADYILKHQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcgtcaccggtctcgccgagatcgtcaacgagatcgcc ggtatcccggtcgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaagagcgcttcgacgtcaagatcccc gacgaggacgtcaagaacctcaagacggtcggcgacgccgccgactacatcctgaagcac cagggctga

DBGET integrated database retrieval system