Streptomyces aurantiacus: GCM10017557_43430 Help Entry GCM10017557_43430 CDS       T07085                                  Name (GenBank) translocase   KO K03116   sec-independent protein translocase protein TatA Organism sgm  Streptomyces aurantiacus Pathway sgm03060   Protein export sgm03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:sgm00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     GCM10017557_43430  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     GCM10017557_43430  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:sgm02044]     GCM10017557_43430 Secretion system [BR:sgm02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    GCM10017557_43430 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  BCL29484 UniProt:  A0A7G1P6J5 LinkDB All DBs Position complement(5001051..5001260) Genome browser AA seq 69 aa AA seqDB search MFGLSEFAVVLVVVIIVLAVKKGPDLVRSAGRSARALKAEEKGAGDAAVPRVVPGETVGP ARGAADSRG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgttcgggttgagcgaattcgccgtcgtccttgtcgtcgtcatcatcgtcctggccgtg aagaagggcccggatctggtccgttcggcgggcaggtccgcgcgcgctctcaaggcggag gagaagggtgccggggatgcggcggtgccgcgtgtcgtcccgggcgagacggtgggtccg gcgcggggcgctgccgattcgcggggctga

DBGET integrated database retrieval system