Streptomyces gobiensis: test1122_13720 Help Entry test1122_13720    CDS       T08145                                  Name (GenBank) hypothetical protein   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism sgob  Streptomyces gobiensis Pathway sgob00362   Benzoate degradation sgob00621   Dioxin degradation sgob00622   Xylene degradation sgob01100   Metabolic pathways sgob01120   Microbial metabolism in diverse environments sgob01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:sgob00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     test1122_13720    00622 Xylene degradation     test1122_13720    00621 Dioxin degradation     test1122_13720 Enzymes [BR:sgob01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      test1122_13720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Motif Other DBs NCBI-ProteinID:  UGY92675 LinkDB All DBs Position complement(2957367..2957597) Genome browser AA seq 76 aa AA seqDB search MCRPSPTSPRDFTEEQSQAIDAAVSKAVMDTFDTGEETISIALEPIAKNDWNEQVLAEIF AREDLLIRAPAYGKKK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt gtgtgccgccccagccccacctcacccagggacttcaccgaagagcagagccaggcgatc gacgcggcggtcagcaaggccgtcatggacaccttcgacaccggagaagagaccatctcg atcgcgctggagccgatcgcgaagaacgactggaacgagcaagtcctcgcagagatcttc gcgcgggaggacctgctgatcagagcacccgcttacgggaagaagaagtga

DBGET integrated database retrieval system