Streptomyces gobiensis: test1122_15625 Help Entry test1122_15625    CDS       T08145                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism sgob  Streptomyces gobiensis Pathway sgob00253   Tetracycline biosynthesis sgob01056   Biosynthesis of type II polyketide backbone sgob01100   Metabolic pathways sgob01110   Biosynthesis of secondary metabolites Module sgob_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:sgob00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     test1122_15625    00253 Tetracycline biosynthesis     test1122_15625  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:sgob01004]     test1122_15625    01008 Polyketide biosynthesis proteins [BR:sgob01008]     test1122_15625 Lipid biosynthesis proteins [BR:sgob01004]  Polyketide synthase   Component type    test1122_15625 Polyketide biosynthesis proteins [BR:sgob01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      test1122_15625     Nonaketide PKS      test1122_15625     Decaketide PKS      test1122_15625 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 DUF7080 PrpR_N Motif Other DBs NCBI-ProteinID:  UGY92999 LinkDB All DBs Position complement(3341361..3341618) Genome browser AA seq 85 aa AA seqDB search MSIMTIDDLQRILVQGAGADESIDLSGDIQDVEFEDLGYDSLAMLETAARIQQQYGVVLS DEQILELRTPRQVVDAVNSTAAGVN NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagcatcatgaccatcgacgatctgcagcgcatccttgtgcagggggcgggcgccgac gagtcgatcgacctgtcgggcgatatccaggacgttgagttcgaggacctcggttatgac tcgctggccatgctggagacggcggcgcgcattcagcagcagtacggcgtagtcctgtcg gatgaacagatcctggagctgcgcacgccccgccaggttgtcgacgcggtgaactccacc gccgccggagtgaactga

DBGET integrated database retrieval system