Scandinavium goeteborgense: A8O29_001845 Help Entry A8O29_001845      CDS       T06630                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sgoe  Scandinavium goeteborgense Pathway sgoe01100   Metabolic pathways sgoe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgoe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A8O29_001845    00074 Mycolic acid biosynthesis     A8O29_001845   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A8O29_001845 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QKN80090 LinkDB All DBs Position complement(241039..241296) Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIIQTLNLDELSADDIDTDAPLFGDGLGLDSIDALELGLAVKNQYGVVLS AESEEMRQHFYSVATLASFINAQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagccctctatcttgaaataaaaaacctcatcattcagaccctgaatcttgatgag ctgtcagcggatgatatcgacaccgatgctcccctctttggagacggcctgggcctggac tctatcgatgcactggagctgggactggcggtaaagaatcagtacggcgtggtgctttca gcagaaagcgaagagatgcgtcagcatttctattccgtcgccacactggcgtcctttatt aacgctcaacgcgcgtga

DBGET integrated database retrieval system