KEGG   Scandinavium goeteborgense: A8O29_009625
Entry
A8O29_009625      CDS       T06630                                 
Symbol
phnC
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
sgoe  Scandinavium goeteborgense
Pathway
sgoe02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sgoe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    A8O29_009625 (phnC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sgoe02000]
    A8O29_009625 (phnC)
Enzymes [BR:sgoe01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     A8O29_009625 (phnC)
Transporters [BR:sgoe02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    A8O29_009625 (phnC)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_29 MMR_HSR1 KdpD AAA_23 NB-ARC AAA_16 AAA_30 Cellulase MeaB DO-GTPase2 AAA_22 nSTAND1
Other DBs
NCBI-ProteinID: QKN81527
LinkDB
Position
1849477..1850319
AA seq 280 aa
MNNARALFSLNDYPLQPQILHAPQRKVLSVKNLCKSYNAQQKVLNDINFDLHAGEMVGIV
GRSGAGKSTLLHVLNGTHSATSGELLSYPEVGLPHDVSGISGRALNAWRSECGMIFQDFC
LVPRLDVLTNVLLGRLSQTSTFKSLFKVFSDDDRARAIALLEWMNMLPHALQRAENLSGG
QMQRVAICRALIQNPSILLADEPVASLDPKNTQRIMTVLREVSEQGISVMVNLHSIELVK
NYCTRVIGIAQGQIVFDGHPDDLSPDVLQELYGDEISQLH
NT seq 843 nt   +upstreamnt  +downstreamnt
atgaacaacgctcgcgcactcttttccctgaacgattatccgcttcaaccgcagattctt
cacgccccacagcgcaaagtgctgagcgtgaaaaacttatgcaagtcgtacaacgcccag
caaaaggtgctgaacgacatcaattttgacctgcatgcgggtgaaatggtcgggatcgtc
gggcgttcgggagcggggaaatccacgctgctgcacgtgctcaacggcactcactccgcc
acctctggcgaactgctcagctacccggaagtcggtctcccgcatgatgtctccggcatc
agcggacgcgcgctcaatgcgtggcgcagcgaatgcggcatgattttccaggacttctgc
ctggtcccgcgtctcgacgtgctgaccaacgttttgctcggtcgactgagccagacttca
accttcaaatccctgttcaaagtgttctcggacgatgaccgcgctcgcgccatcgcgctg
ctcgaatggatgaacatgttgcctcatgcgctacagcgtgcagaaaacctctccggcggg
cagatgcagcgcgtggcgatttgccgggcgcttatccagaatccctcgattctgctggcc
gacgagccggtggcctcgctcgacccgaaaaacacccagcgcatcatgacggtcctgcgt
gaagtcagcgagcagggcatcagcgtgatggtcaacctgcactcaattgagctggtgaaa
aattactgcacccgcgtgataggcatcgcgcaggggcaaatcgtgtttgacggacatcca
gatgacttaagcccggatgtcctgcaagaactatatggcgacgaaatcagccaattacat
tga

DBGET integrated database retrieval system