Streptomyces griseus: SGR_2168 Help Entry SGR_2168          CDS       T00691                                  Name (GenBank) putative ATP synthase C chain   KO K02110   F-type H+-transporting ATPase subunit c Organism sgr  Streptomyces griseus Pathway sgr00190   Oxidative phosphorylation sgr01100   Metabolic pathways Module sgr_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:sgr00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     SGR_2168  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:sgr00194]     SGR_2168 Photosynthesis proteins [BR:sgr00194]  Photosystem and electron transport system   F-type ATPase [OT]    SGR_2168 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C CSTF2_hinge Motif Other DBs NCBI-ProteinID:  BAG18997 Kitasato:  SGR2168 UniProt:  B1W0A8 LinkDB All DBs Position complement(2568541..2568777) Genome browser AA seq 78 aa AA seqDB search MSAAFETLAAVNGNVGTIGYGLAAIGPGIGIGIIFGNGVQAIARQPEAAGLIRQNMLLGF AVVEALALIGFVVPFIVK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtctgctgctttcgagaccctcgcggccgtgaacggcaacgtcggcaccatcggctac ggcctcgccgcgatcggccccggcatcggcatcggcatcatcttcggtaacggtgtgcag gccatcgcccgccagcccgaggctgccggcctcatccgccagaacatgctgctcggcttc gccgtcgtcgaggccctggccctgatcggcttcgtcgttccgttcatcgtcaagtga

DBGET integrated database retrieval system