KEGG   Streptomyces griseus: SGR_4005
Entry
SGR_4005          CDS       T00691                                 
Name
(GenBank) putative phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sgr  Streptomyces griseus
Pathway
sgr00010  Glycolysis / Gluconeogenesis
sgr00260  Glycine, serine and threonine metabolism
sgr00680  Methane metabolism
sgr01100  Metabolic pathways
sgr01110  Biosynthesis of secondary metabolites
sgr01120  Microbial metabolism in diverse environments
sgr01200  Carbon metabolism
sgr01230  Biosynthesis of amino acids
Module
sgr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sgr_M00002  Glycolysis, core module involving three-carbon compounds
sgr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGR_4005
  09102 Energy metabolism
   00680 Methane metabolism
    SGR_4005
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SGR_4005
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sgr04131]
    SGR_4005
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sgr04147]
    SGR_4005
Enzymes [BR:sgr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SGR_4005
Membrane trafficking [BR:sgr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SGR_4005
Exosome [BR:sgr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SGR_4005
  Exosomal proteins of melanoma cells
   SGR_4005
SSDB
Motif
Pfam: His_Phos_1 PG_isomerase_N
Other DBs
NCBI-ProteinID: BAG20834
Kitasato: SGR4005
UniProt: B1VS80
LinkDB
Position
complement(4688490..4689251)
AA seq 253 aa
MADAPYKLILLRHGESEWNAKNLFTGWVDVNLTEKGEKEAVRGGELLKDAGLLPDVLHTS
LQRRAIRTAQLALESADRLWIPVRRSWRLNERHYGALQGKDKAQTLAEFGEEQFMLWRRS
YDTPPPPLARDDEFSQFDDPRYATLPPEVRPDTECLKDVVVRMLPYWFDSIVPDLLTGRT
VLVAAHGNSLRGLVKHLDGISDEDISGLNIPTGIPLSYELDADFKPLKPGGTYLDPDAAK
AAIEAVKNQGKKK
NT seq 762 nt   +upstreamnt  +downstreamnt
atggccgacgcaccgtacaagctgatcctcctccgccacggcgagagcgaatggaacgcg
aagaacctgttcaccggttgggtggacgtcaacctcaccgagaagggcgagaaggaagca
gtccgcggcggtgagctgctcaaggacgccggtctgctccccgacgtcctgcacacctcg
ctccagcggcgcgcgatccggaccgcccagctggccctggagtccgccgaccgcctctgg
atcccggtccgccgctcctggcggctgaacgagcgccactacggcgcgctccagggcaag
gacaaggcgcagacgctcgccgagttcggcgaggagcagttcatgctgtggcgccgctcg
tacgacaccccgccgccgccgctggcccgcgacgacgagttcagccagttcgacgacccg
cgctacgcgaccctcccgccggaggtgcgcccggacacggagtgcctgaaggacgtcgtc
gtccgcatgctcccgtactggttcgacagcatcgtcccggacctcctcaccggccgcacg
gtcctggtcgccgcccacggcaacagcctgcgcggtctggtgaagcacctggacggcatc
tcggacgaggacatctcgggcctcaacatcccgacgggcatcccgctctcctacgagctc
gacgccgacttcaagccgctgaagccgggcggcacgtacctggacccggacgcggcgaag
gccgccatcgaggccgtgaagaaccagggcaagaagaagtag

DBGET integrated database retrieval system