Streptomyces griseus: SGR_5106 Help Entry SGR_5106          CDS       T00691                                  Symbol fabC Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism sgr  Streptomyces griseus Pathway sgr00998   Biosynthesis of various antibiotics sgr01100   Metabolic pathways sgr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SGR_5106 (fabC)    00074 Mycolic acid biosynthesis     SGR_5106 (fabC)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SGR_5106 (fabC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  BAG21935 Kitasato:  SGR5106 UniProt:  B1VYF0 LinkDB All DBs Position complement(6018357..6018605) Genome browser AA seq 82 aa AA seqDB search MAATQEEIVKGLAEIVNEIAGIPEEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDAADYILKHQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccacgcaggaagagatcgtcaagggtctcgccgagatcgtcaacgagatcgcc ggcatcccggaggaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgacgtcaagatcccc gacgaggacgtcaagaacctcaagacggtcggcgacgccgccgactacatcctgaagcac cagggctga

DBGET integrated database retrieval system