Streptomyces griseus: SGR_6638 Help Entry SGR_6638          CDS       T00691                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism sgr  Streptomyces griseus Pathway sgr00998   Biosynthesis of various antibiotics sgr01100   Metabolic pathways sgr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SGR_6638    00074 Mycolic acid biosynthesis     SGR_6638   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SGR_6638 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BAG23467 Kitasato:  SGR6638 UniProt:  B1VLS6 LinkDB All DBs Position 7930759..7931034 Genome browser AA seq 91 aa AA seqDB search MQTIHPKITEVLTATFKVPAAEILPESTMDSLEMDSLAVAEFAVVIKETLGVDADSEKLY KGSTLADISAYIDAVVGGAGAEATVPVSNTR NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgcagaccatccaccccaagatcaccgaggtgctgaccgcgacgttcaaggtgcccgcc gccgagatccttccggagtccaccatggacagcctggagatggactccctcgcggtcgcc gagttcgccgtcgtcatcaaggagaccctgggcgtcgacgcggactcggagaagctgtac aagggctccacgctggccgacatctccgcgtacatcgacgcggtcgtcggcggcgcgggc gccgaggccacggtgccggtgagcaacacccgatga

DBGET integrated database retrieval system