Schistocerca gregaria (desert locust): 126304652 Help Entry 126304652         CDS       T08688                                  Name (RefSeq) rho-related protein racB-like   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism sgre  Schistocerca gregaria (desert locust) Pathway sgre04013   MAPK signaling pathway - fly sgre04145   Phagosome sgre04148   Efferocytosis sgre04310   Wnt signaling pathway sgre04620   Toll-like receptor signaling pathway sgre05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sgre00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     126304652    04310 Wnt signaling pathway     126304652  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     126304652    04148 Efferocytosis     126304652  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     126304652  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     126304652  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sgre04131]     126304652   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sgre04147]     126304652    04031 GTP-binding proteins [BR:sgre04031]     126304652 Membrane trafficking [BR:sgre04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     126304652  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     126304652   Macropinocytosis    Ras GTPases     126304652  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     126304652 Exosome [BR:sgre04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    126304652   Exosomal proteins of other body fluids (saliva and urine)    126304652   Exosomal proteins of colorectal cancer cells    126304652   Exosomal proteins of bladder cancer cells    126304652 GTP-binding proteins [BR:sgre04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     126304652 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA Motif Other DBs NCBI-GeneID:  126304652 NCBI-ProteinID:  XP_049847781 LinkDB All DBs Position Unknown AA seq 198 aa AA seqDB search MAMQSVKLVVVGDGAVGKTCLLIAYTSNSFPKEYVPTVFDNYNANVRVADKTVSLSLWDT AGQEDYDRLRPLSYPQTDVFLICFSVISPTSFSNVRTKWWPEVTHHCPGAKIILVGTKLD LREDNDKLESLKEKGLSPVTTEQGRDMANEIKAVNFMECSALTQKCLKEVFDEAIRAVVL PSRNQKVSKRGRAACILL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atggctatgcaaagtgttaaactagtcgtagtcggcgacggcgctgtcggtaaaacatgc cttcttattgcctacacaagtaattcctttcccaaggaatatgttcctacagtgtttgac aattataatgccaacgtccgagtagccgacaaaacagtaagtctgtccctctgggatact gctggtcaggaggattatgatcgactgagacctctaagctatcctcagaccgatgtattt ttgatctgctttagtgttatttctcctacttctttttctaatgttcgaacgaagtggtgg ccagaagttactcatcattgtcccggtgcaaaaatcattctggttggcactaaactagat ctccgagaagacaacgataaattagaatcccttaaagagaagggtctatctcctgttacg actgagcaaggaagggacatggctaacgagattaaagctgttaactttatggaatgttct gcattaacacagaaatgtttgaaggaagtgtttgatgaggctattagagctgtcgtattg ccatctagaaaccaaaaagtatcaaaacgtggtcgtgctgcttgcatcctcttgtaa

DBGET integrated database retrieval system