Schistocerca gregaria (desert locust): 126334743 Help Entry 126334743         CDS       T08688                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism sgre  Schistocerca gregaria (desert locust) Pathway sgre04013   MAPK signaling pathway - fly sgre04145   Phagosome sgre04148   Efferocytosis sgre04310   Wnt signaling pathway sgre04517   IgSF CAM signaling sgre04518   Integrin signaling sgre04620   Toll-like receptor signaling pathway sgre05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:sgre00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     126334743    04310 Wnt signaling pathway     126334743   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     126334743    04518 Integrin signaling     126334743  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     126334743    04148 Efferocytosis     126334743  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     126334743  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     126334743  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sgre04131]     126334743   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sgre04147]     126334743    04031 GTP-binding proteins [BR:sgre04031]     126334743 Membrane trafficking [BR:sgre04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     126334743  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     126334743   Macropinocytosis    Ras GTPases     126334743  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     126334743 Exosome [BR:sgre04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    126334743   Exosomal proteins of other body fluids (saliva and urine)    126334743   Exosomal proteins of colorectal cancer cells    126334743   Exosomal proteins of bladder cancer cells    126334743 GTP-binding proteins [BR:sgre04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     126334743 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  126334743 NCBI-ProteinID:  XP_049853249 LinkDB All DBs Position 2:complement(677872339..677966759) Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPTTPIILVGTKLDLR EDKDTIEKLKDKKLAPITYPQGLAMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV LQVKPKRKCVLI NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagctattaaatgtgttgttgttggtgatggtgctgtgggtaaaacatgtcttctc atcagttacacaaccaatgccttcccaggagaatatattcccactgtgtttgacaactat tctgccaatgtgatggtggatgggaagcccatcaatttgggtctatgggatacagcagga caagaagattatgataggctgcggcctttgtcctatccacaaacggatgtcttcctaatc tgcttttcactagtcaatccagcatctttcgagaacgttagagcgaagtggtatccagaa gtaagacatcactgtccaaccacccccattattcttgtgggaacaaaactggatcttagg gaagacaaagacacaattgaaaaactaaaagacaagaagttagcaccaattacataccca cagggactagctatggcaaaggagattggtgcagtgaagtatcttgagtgcagtgctctc actcagaagggactcaaaacagtttttgatgaggcaatccgagccgtattatgcccagtg ctgcaagttaaaccgaaaaggaagtgtgtgcttatataa

DBGET integrated database retrieval system