Schistocerca gregaria (desert locust): 126338861 Help Entry 126338861         CDS       T08688                                  Name (RefSeq) elongin-B isoform X1   KO K03873   elongin-B Organism sgre  Schistocerca gregaria (desert locust) Pathway sgre04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:sgre00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     126338861  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sgre04121]     126338861    03400 DNA repair and recombination proteins [BR:sgre03400]     126338861 Ubiquitin system [BR:sgre04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      126338861    Cul5 complex      126338861 DNA repair and recombination proteins [BR:sgre03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      126338861 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Motif Other DBs NCBI-GeneID:  126338861 NCBI-ProteinID:  XP_049857541 LinkDB All DBs Position 1:241002594..241039944 Genome browser AA seq 123 aa AA seqDB search MILGNIIDVFLMIRRKKLTIFTDAKDTTSVHELKKIIEGIIKVPPGNQQLFNKDNQIMED DKMLQDYGLTSSVAKAQSPAAVGLALRQETGDFEPLEITPFSSPPDLPDVMKSQESNGQE QTS NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgattttaggaaatataatcgatgtatttttaatgatcaggagaaaaaagctcacaatt tttacagatgcaaaggatacaacgtcagttcacgaacttaagaaaataattgaaggaatt attaaagtaccacctggtaatcaacagttatttaataaagataatcaaataatggaagat gataaaatgttacaagattatggtcttacttcaagtgtagcgaaagctcagagtccagca gctgtgggactagctctgaggcaggaaactggtgattttgaaccactagaaattacgcca ttttcatcgcctccagatcttcctgatgtaatgaaatcacaagaaagcaatggccaggaa caaacatcatga

DBGET integrated database retrieval system