Streptomyces graminofaciens: SGFS_016310 Help Entry SGFS_016310       CDS       T09325                                  Name (GenBank) hypothetical protein   KO K05553   minimal PKS acyl carrier protein Organism sgrf  Streptomyces graminofaciens Pathway sgrf00253   Tetracycline biosynthesis sgrf01056   Biosynthesis of type II polyketide backbone sgrf01100   Metabolic pathways sgrf01110   Biosynthesis of secondary metabolites Module sgrf_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:sgrf00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     SGFS_016310    00253 Tetracycline biosynthesis     SGFS_016310  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:sgrf01004]     SGFS_016310    01008 Polyketide biosynthesis proteins [BR:sgrf01008]     SGFS_016310 Lipid biosynthesis proteins [BR:sgrf01004]  Polyketide synthase   Component type    SGFS_016310 Polyketide biosynthesis proteins [BR:sgrf01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      SGFS_016310     Nonaketide PKS      SGFS_016310     Decaketide PKS      SGFS_016310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BBC30337 LinkDB All DBs Position complement(1808139..1808414) Genome browser AA seq 91 aa AA seqDB search MPSETEIFDVGDLRRILREGAGADENVDLEGDILDVDFEALGYDSLARLETGGRIEREFR IKLADETLTEVATPRELIDAVNAQLRSTPAG NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgccttccgaaaccgagatcttcgacgtgggtgacctgaggagaattctgcgagaaggg gccggtgcggacgaaaacgtcgacctcgaaggtgacatactcgatgtcgacttcgaggcg cttggctatgactcgctcgcgaggctggagaccggcggacgtatagagcgcgagttcaga attaagctcgcggacgagactcttaccgaggtcgccacaccgcgcgagctgatcgacgct gtgaacgcccagttgcgttccacgccggccggctga

DBGET integrated database retrieval system