Streptomyces graminofaciens: SGFS_080500 Help Entry SGFS_080500       CDS       T09325                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism sgrf  Streptomyces graminofaciens Pathway sgrf00998   Biosynthesis of various antibiotics sgrf01100   Metabolic pathways sgrf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgrf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SGFS_080500    00074 Mycolic acid biosynthesis     SGFS_080500   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SGFS_080500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  BBC36756 LinkDB All DBs Position complement(8965289..8965537) Genome browser AA seq 82 aa AA seqDB search MAATQEEIVAGLADIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DDDVKNLKTVGDATDYILKNQG NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcgtcgccggtctcgccgacatcgtgaacgagatcgcc ggcatcccggtcgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tccctgtccatggtcgaggtcgtcgtcgccgccgaagagcgcttcgacgtcaagatcccg gacgacgacgtcaagaacctcaagacggtcggcgacgccaccgactacatcctcaagaac cagggctga

DBGET integrated database retrieval system