Streptomyces graminofaciens: SGFS_100850 Help Entry SGFS_100850       CDS       T09325                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism sgrf  Streptomyces graminofaciens Pathway sgrf03060   Protein export sgrf03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:sgrf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     SGFS_100850  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     SGFS_100850  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:sgrf02044]     SGFS_100850 Secretion system [BR:sgrf02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    SGFS_100850 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E DUF5437 Motif Other DBs NCBI-ProteinID:  BBC38791 LinkDB All DBs Position complement(11191231..11191491) Genome browser AA seq 86 aa AA seqDB search MFGLSELAIILVVVIAALAAKKLPDLARSAGKSARILKAEARGTKEEDRAGADENTTPRV IRGETVTRHDNTGAGRPPAPGSAPRP NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgttcggactgagtgaactcgcgatcatcctcgtcgtcgtgatagccgccctcgccgcc aagaagctgcccgacctggcccgttcggcgggcaagtcggcccgcatcctcaaggccgag gcccgcggtacaaaggaggaggacagggccggcgcggatgagaacaccacaccgcgggtg atccggggcgagaccgtcacccgccatgacaacaccggcgcgggccggcctcccgcgccg ggctcggccccgcggccgtag

DBGET integrated database retrieval system