Solicola gregarius: L0C25_00585 Help Entry L0C25_00585       CDS       T09807                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sgrg  Solicola gregarius Pathway sgrg01100   Metabolic pathways sgrg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgrg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     L0C25_00585    00074 Mycolic acid biosynthesis     L0C25_00585   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     L0C25_00585 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  UYM05616 UniProt:  A0AA46TI51 LinkDB All DBs Position 123051..123299 Genome browser AA seq 82 aa AA seqDB search MATTEEIRSDLAEIVNEVAGVPADDVALDKSFTDDLDVDSLSMVEVVVAAEEKFSVTIPD DDVKNLKTVGDAVAYIERAQGA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccaccaccgaagagatccgctccgacctcgccgagatcgtcaacgaggtcgccggc gtacctgcggatgacgtcgccctcgacaagtcgttcaccgacgacctggacgtcgactcc ctgtcgatggtcgaggtcgtcgtcgccgccgaggagaagttcagcgtcaccatccccgac gacgacgtgaagaacctgaagacggtcggcgacgcggtcgcgtacatcgagcgcgcacaa ggcgcctga

DBGET integrated database retrieval system