Serratia grimesii: SGBXF1_04703 Help Entry SGBXF1_04703      CDS       T09948                                  Symbol zapB Name (GenBank) Cell division protein ZapB   KO K09892   cell division protein ZapB Organism sgri  Serratia grimesii Brite KEGG Orthology (KO) [BR:sgri00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sgri03036]     SGBXF1_04703 (zapB) Chromosome and associated proteins [BR:sgri03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     SGBXF1_04703 (zapB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB CtIP_N Seryl_tRNA_N PspA_IM30 Leu_zip UPF0242 DUF3450 Nuf2_DHR10-like DUF7801 FlaC_arch Herpes_UL6 DUF7491 YabA ADIP COG6_N USHBP1_PDZ-bd dCache_2 V_ATPase_I ERM_helical Cnn_1N bZIP_2 DUF4757 APG6_N HALZ COG3_N Rx_N DivIC DUF2968 DUF6262 Motif Other DBs NCBI-ProteinID:  SMZ59038 LinkDB All DBs Position 1:complement(5003058..5003297) Genome browser AA seq 79 aa AA seqDB search MSFEVFEKLESKVQQAIDTITLLQMEIEELKDKNNTLSQEVQAASGNHESLVRENQQLKE EQHVWQDRLRALLGKMEEV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcatttgaagtatttgagaaattggaatcaaaagttcagcaggcgatcgataccatc accctgctgcagatggaaattgaagagctgaaagacaaaaacaatactctgtctcaggaa gttcaggctgcctctggcaaccacgaatcgctggtacgtgaaaaccagcaactgaaagaa gagcagcacgtatggcaagaccgcctgcgcgcgctgttgggcaaaatggaagaagtctga

DBGET integrated database retrieval system