Streptomyces griseoaurantiacus: V9K83_20620 Help Entry V9K83_20620       CDS       T10677                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism sgrs  Streptomyces griseoaurantiacus Brite KEGG Orthology (KO) [BR:sgrs00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sgrs03032]     V9K83_20620    03036 Chromosome and associated proteins [BR:sgrs03036]     V9K83_20620    03400 DNA repair and recombination proteins [BR:sgrs03400]     V9K83_20620 DNA replication proteins [BR:sgrs03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     V9K83_20620 Chromosome and associated proteins [BR:sgrs03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     V9K83_20620 DNA repair and recombination proteins [BR:sgrs03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       V9K83_20620 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding Urease_beta HU-HIG Motif Other DBs NCBI-ProteinID:  WWY86422 LinkDB All DBs Position 4689836..4690117 Genome browser AA seq 93 aa AA seqDB search MNRSELVAALADRAEVTRKDADAVLAAFAETVGEIVAKGDEKVTIPGFLTFERTHRAART ARNPQTGDPIQIPAGYSVKVSAGSKLKEAAKGN NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcagtgagctggtggccgcgctggccgaccgcgccgaggtgacccgcaaggac gccgacgccgttctggccgccttcgccgagacggtcggcgagatcgtcgccaagggcgac gagaaggtcaccatccccggcttcctgaccttcgagcgcacccaccgtgccgctcgcacc gcgcgcaacccgcagaccggcgaccccatccagatcccggccggctacagcgtgaaggtg tcggcgggcagcaagctcaaggaagccgcgaagggcaactga

DBGET integrated database retrieval system