Streptomyces griseochromogenes: AVL59_13095 Help Entry AVL59_13095       CDS       T04729                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism sgs  Streptomyces griseochromogenes Pathway sgs00998   Biosynthesis of various antibiotics sgs01100   Metabolic pathways sgs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AVL59_13095    00074 Mycolic acid biosynthesis     AVL59_13095   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AVL59_13095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding YyzF Motif Other DBs NCBI-ProteinID:  ANP50429 UniProt:  A0A1B1AV15 LinkDB All DBs Position 3078767..3079003 Genome browser AA seq 78 aa AA seqDB search MFVPYLSDLLEKSYKVPAPIDPDKSFQELEVDSLSLAELGAHLEDELDVTIDEEELTPAT TVTALAGLLEARGAVLTA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgttcgtcccctacctctccgacctcctcgagaagtcctacaaggtccccgcccccatc gaccccgacaagtccttccaggagctggaggtggactcgctgtcgctggcggaactcggc gcacacctggaggacgagctcgacgtcaccatcgacgaggaggagctcacacccgcgacc accgtgaccgcgctggccgggctcctggaggcccggggggcggtcctgacggcatga

DBGET integrated database retrieval system