Streptomyces griseochromogenes: AVL59_24300 Help Entry AVL59_24300       CDS       T04729                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sgs  Streptomyces griseochromogenes Pathway sgs00998   Biosynthesis of various antibiotics sgs01100   Metabolic pathways sgs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AVL59_24300    00074 Mycolic acid biosynthesis     AVL59_24300   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AVL59_24300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 PH_15 Motif Other DBs NCBI-ProteinID:  ANP56745 UniProt:  A0A1B1BD34 LinkDB All DBs Position 5688555..5688836 Genome browser AA seq 93 aa AA seqDB search MKLDEATRRAAARQDLCSQVKQLLVDRLSLDVAPRAIGDDQPLFGRGLELDSIDTLELAM AVEDTFGVTVTDDDTQSLLSLNRLVDHIEGARA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaactcgatgaggcgacccgccgggcggcggcccgacaggacctgtgctcgcaggtc aagcagctgctcgtggaccgcctttcactggacgtcgccccccgggcaatcggggacgac cagccgctgttcggacgcgggctggagctggactccatcgacacgctggaactggccatg gcggtggaggacactttcggtgtcaccgtcaccgacgacgacacccagagcctgctgtcg ttgaaccggctggtcgaccacatcgagggcgcccgagcatga

DBGET integrated database retrieval system