Streptomyces griseochromogenes: AVL59_39065 Help Entry AVL59_39065       CDS       T04729                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sgs  Streptomyces griseochromogenes Pathway sgs00998   Biosynthesis of various antibiotics sgs01100   Metabolic pathways sgs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AVL59_39065    00074 Mycolic acid biosynthesis     AVL59_39065   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AVL59_39065 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ANP54802 UniProt:  A0A1B1B7T9 LinkDB All DBs Position 8974899..8975147 Genome browser AA seq 82 aa AA seqDB search MAATQEEIVAGLAEIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKSVGDATDYILKHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagattgtcgccggtctcgccgagatcgtgaacgagatcgcc gggatccccgttgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgacgtgaagatcccg gacgaggacgtcaagaacctgaagtccgtcggcgacgccaccgactacatcctcaagcac caggcctga

DBGET integrated database retrieval system