KEGG   Streptomyces glaucescens: SGLAU_00205
Entry
SGLAU_00205       CDS       T03327                                 
Name
(GenBank) class III aminotransferase
  KO
K20435  validone 7-phosphate aminotransferase [EC:2.6.1.-]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00525  Acarbose and validamycin biosynthesis
sgu01100  Metabolic pathways
sgu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    SGLAU_00205
Enzymes [BR:sgu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-
     SGLAU_00205
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-ProteinID: AIR96069
UniProt: A0A089X4U2
LinkDB
Position
49357..50640
AA seq 427 aa
MALPLSADPHDVAYHELGPDLLVRGEGVRVWDEKGREYLDCVSGTFNLILGHNHPAVLAA
VREQSEHLVFASSAFQTEPTNRVMQLLAELTPANLTRVNLRSCSGSTANEGAIKIAQLHT
GRRDVIVPFRGQVGQSLAATAYNGLARMRAPFPQHHPGAVNVPDPYCRRCFYRQSPDSCG
FWCVDRIDDFLTYSGSGSTACLIIEPISGVGGNVVPPPGYLERLREFCTERGIVLIFDEM
QTAFGRTGQLFAADHFGVQPDIMTVSKGLTGSGLPLAAILTEERFVGMERSLHGFTYGSH
TLSAAAAAVTLEIVSRPEFLAQVRAVGAVLLERLRALQAGHPCVFDVRGVGLMLGIEVAE
PDGTRSSSLAHTLHQALAERSVITRVSEHGQGNVIELRPPLILTLQDAHLIADRFGEALE
SMPRTAR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggcgctgcctctgtccgctgatccgcacgatgtcgcctaccacgagctcggtcccgat
ctccttgtccggggcgagggggtgagggtctgggacgagaaggggcgcgagtacctggat
tgtgtgtccggcaccttcaacctgatcctcggccacaaccacccggccgtccttgccgct
gtcagggaacagtccgaacatctcgtcttcgccagctcggcgttccagaccgaacccacc
aaccgcgtcatgcagctcctggcggaactgacccctgccaacctgacccgggtcaacctc
cgcagttgcagcggatcgacggcgaacgagggcgccatcaagattgcccagctgcacacg
ggacgccgggacgtgatcgtccccttccgcggccaggtcggccagtcgctcgccgcgacg
gcgtacaacggactggcgcggatgcgggcccccttcccccagcaccatcccggcgccgtg
aacgtgcccgacccgtactgccggcgctgtttctatcgtcagagccccgactcgtgcggc
ttttggtgcgtggaccgcatcgacgacttcctcacctactccggatccggcagcaccgcc
tgcctgatcatcgagcccatcagcggcgtcggcggcaacgttgttccgccgcccggctac
ctcgagcgtctgcgggagttctgcaccgaacgcggcatcgtcctgatcttcgacgagatg
cagaccgcgttcggtcgcaccgggcagctcttcgccgcggaccacttcggcgtccagccg
gacatcatgaccgtctccaagggtttgaccggctcaggcttgcctctggccgcgatcctc
accgaggaacgcttcgtcggcatggaacgctccctgcacggcttcacctacggcagccac
accctgtccgccgccgcggcggccgtcaccctggagatcgtcagccgtccggagttcctc
gctcaggtacgcgcggtcggcgccgtcctgctcgagcgcctccgagcgctccaggccggc
cacccttgcgtcttcgatgtccgcggcgtcggcctcatgctcggtatcgaggtcgccgaa
cccgacggcacccgctcctcgtccctcgcgcacaccctgcaccaggctctggccgagcgc
tccgtcatcacccgcgtctccgaacacggccagggcaacgtcatcgaactccgtccccca
ctgatcctcaccctccaggacgcccacctgatcgccgaccgcttcggcgaggcgttggaa
tccatgccacgcaccgcgcgctga

DBGET integrated database retrieval system