Streptomyces glaucescens: SGLAU_06740 Help Entry SGLAU_06740       CDS       T03327                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism sgu  Streptomyces glaucescens Pathway sgu03060   Protein export sgu03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:sgu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     SGLAU_06740  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     SGLAU_06740  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:sgu02044]     SGLAU_06740 Secretion system [BR:sgu02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    SGLAU_06740 SSDB OrthologParalogGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  AIR97364 UniProt:  A0A089X8F6 LinkDB All DBs Position complement(1529623..1529907) Genome browser AA seq 94 aa AA seqDB search MFGGKLGAPEIILILVVIILLFGAKKLPDMARSLGKSARILKSEAKAMKEDGKSSAPADP PHTTDDSAQRVIQAAPGDVSSSRPVTEPTDTTKR NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgttcggaggaaagctcggagcccccgagattattctcatcctcgtcgtcatcatcctg ctcttcggcgcgaagaagcttccggacatggcccgctcgctcggcaagtccgcgcgcatc ctcaagagcgaggccaaggcgatgaaggaggacgggaagtcctccgcgccggccgacccg ccgcacaccaccgacgactccgcgcagcgcgtcatccaggccgcacccggtgacgtgtcc agctcccgcccggtcaccgagccgacggacacgaccaagcgctga

DBGET integrated database retrieval system