KEGG   Streptomyces glaucescens: SGLAU_08080
Entry
SGLAU_08080       CDS       T03327                                 
Symbol
moaA
Name
(GenBank) Cyclic pyranopterin monophosphate synthase
  KO
K03639  GTP 3',8-cyclase [EC:4.1.99.22]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00790  Folate biosynthesis
sgu01100  Metabolic pathways
sgu01240  Biosynthesis of cofactors
sgu04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SGLAU_08080 (moaA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    SGLAU_08080 (moaA)
Enzymes [BR:sgu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.22  GTP 3',8-cyclase
     SGLAU_08080 (moaA)
SSDB
Motif
Pfam: Radical_SAM Mob_synth_C Fer4_12 Radical_SAM_2
Other DBs
NCBI-ProteinID: AIR97628
UniProt: A0A089X3D0
LinkDB
Position
complement(1846429..1847418)
AA seq 329 aa
MLIDTYGRVATDLRVSLTDRCNLRCTYCMPEEGLQWLAKPDLLTDDEIVRLIGIAVTSLG
IEEVRFTGGEPLLRPGLVGIVERVAALSPRPQMSLTTNGIGLRRTAAALKAAGLDRVNVS
LDTLRPDVFKTLTRRDRHKDVLEGLEAAREAGLTPVKVNSVLMPGLNEDEAPDLLAWAVE
HDYELRFIEQMPLDAQHGWKREGMITAGDILASLRTRFELTPEGDEARGSAPAERWLVDG
GPHRVGVIASVTRPFCSACDRTRLTADGQVRTCLFATEETDLRAALRDGAPDEEVARIWR
LAMWGKKAGAGLDDPDFVQPDRPMSAIGG
NT seq 990 nt   +upstreamnt  +downstreamnt
gtgctcatcgacacctacggccgggtggccaccgacctgcgggtctcgctcaccgaccgg
tgcaacctgcgctgcacctactgcatgcccgaagagggcctgcagtggctggccaagccc
gacctgctcacggacgacgagatcgtccgcctcatcggcatcgcggtcacctccctcggt
atcgaggaggtccgcttcaccggcggcgaacccctgctgcgccccggcctcgtcggcatc
gtcgagcgcgtcgcggccctgtcgccccgcccccagatgtccctgacgacgaacggcatc
ggcctcaggcgcaccgcggccgccctcaaggccgccggcctggaccgcgtcaacgtctcg
ctggacaccctgcgccccgacgtcttcaagacgctcacccgccgcgaccggcacaaggac
gtcctggagggcctggaagccgcccgcgaggccggcctcaccccggtcaaggtcaactcc
gtcctgatgccggggctcaacgaggacgaggcccccgacctcctcgcctgggccgtcgag
cacgactacgaactgcggttcatcgagcagatgccgctggacgcccagcacggctggaag
cgcgagggcatgatcaccgcgggcgacatcctcgcctcgctgcgcacccgcttcgagctg
accccggagggcgacgaggcccgcggctccgccccggccgagcgctggctggtcgacggc
ggcccgcaccgggtgggtgtcatcgcctccgtcacccgccccttctgctccgcctgcgac
cgcacccggctcaccgccgacggccaggtccgcacctgcctcttcgccaccgaggagacc
gatctgcgggccgccctgcgcgacggcgcccccgacgaggaggtcgcccgcatctggcgc
ctcgcgatgtggggcaagaaggcgggcgcgggcctcgacgacccggacttcgtccagccg
gaccgcccgatgtcggcgatcggcggctga

DBGET integrated database retrieval system