Streptomyces glaucescens: SGLAU_10975 Help Entry SGLAU_10975       CDS       T03327                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism sgu  Streptomyces glaucescens Pathway sgu00998   Biosynthesis of various antibiotics sgu01100   Metabolic pathways sgu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sgu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SGLAU_10975    00074 Mycolic acid biosynthesis     SGLAU_10975   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SGLAU_10975 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AIR98199 UniProt:  Q54207 LinkDB All DBs Position 2506605..2506853 Genome browser AA seq 82 aa AA seqDB search MAATQEEIVAGLADIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDATEYILKHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcgtcgccggtctcgccgacatcgtgaacgagatcgcc ggcatcccggttgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgacgtcaagatcccc gacgaggacgtcaagaacctcaagacggtcggcgacgcgaccgagtacatcctcaagcac caggcctga

DBGET integrated database retrieval system