Streptomyces glaucescens: SGLAU_21745 Help Entry SGLAU_21745       CDS       T03327                                  Name (GenBank) hypothetical protein   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism sgu  Streptomyces glaucescens Pathway sgu03430   Mismatch repair Brite KEGG Orthology (KO) [BR:sgu00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     SGLAU_21745  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:sgu03400]     SGLAU_21745 Enzymes [BR:sgu01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      SGLAU_21745 DNA repair and recombination proteins [BR:sgu03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      SGLAU_21745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S Spectrin_SYNE1 T2SSF PipA Motif Other DBs NCBI-ProteinID:  AIS00303 UniProt:  A0A089X8Q0 LinkDB All DBs Position complement(4935239..4935490) Genome browser AA seq 83 aa AA seqDB search MTSKVEEALGYEQARDELIEVVRRLEAGGTTLEESLALWERGEELAKVCRRWLEGARARL DAALAEEAAAEEAGTAPSEGEPR NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaccagcaaggtggaagaggcgctcggctacgagcaggcccgggacgagttgatcgag gtcgtccggcggctggaggcgggcggtacgacgctggaggagtccctggcgctctgggag cgcggggaggagctggccaaggtgtgccgccgttggctggagggcgcgcgggcccggctg gacgcggcgctggcggaggaagccgctgcggaggaggccgggacggcgccctccgagggc gagccgcggtag

DBGET integrated database retrieval system