Streptomyces glaucescens: SGLAU_22260 Help Entry SGLAU_22260       CDS       T03327                                  Name (GenBank) hypothetical protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism sgu  Streptomyces glaucescens Brite KEGG Orthology (KO) [BR:sgu00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     SGLAU_22260 Enzymes [BR:sgu01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      SGLAU_22260 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 GST_N_2 Glrx-like GST_N_3 Thioredoxin Motif Other DBs NCBI-ProteinID:  AIS00404 UniProt:  A0A089XB20 LinkDB All DBs Position complement(5056363..5056605) Genome browser AA seq 80 aa AA seqDB search MPGTVTMYSTTWCGYCRRLKSQLDREGITYEEINIEQDPESAAFVEKANGGNQTVPTVLF PDGSTLTNPSLAQVKQKIGV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgccgggcactgtgacgatgtacagcaccacgtggtgcggctactgccgtcggctgaag agccagctcgaccgcgagggcatcacgtacgaagagatcaacatcgagcaggacccggag tcggccgcgttcgtggagaaggcgaacggcgggaaccagaccgtgccgaccgtgctgttc ccggacgggagcaccctgacgaacccgtcgctggcgcaggtcaagcagaagatcggcgtc tga

DBGET integrated database retrieval system