KEGG   Streptomyces glaucescens: SGLAU_23060
Entry
SGLAU_23060       CDS       T03327                                 
Name
(GenBank) ATP synthase F1, epsilon subunit
  KO
K02114  F-type H+-transporting ATPase subunit epsilon
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00190  Oxidative phosphorylation
sgu01100  Metabolic pathways
Module
sgu_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SGLAU_23060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:sgu00194]
    SGLAU_23060
Photosynthesis proteins [BR:sgu00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   SGLAU_23060
SSDB
Motif
Pfam: ATP-synt_DE_N
Other DBs
NCBI-ProteinID: AIS00561
UniProt: A0A089Z432
LinkDB
Position
5229985..5230359
AA seq 124 aa
MAAELHVALVAADREVWSGEATLVVARTTSGDIGVMPGHQPLLGVLESGPVTIRKSDGGT
VVAAVHGGFISFADNKLSLLAEIAELSDEIDVQRAQQELERAKAEGDEAAQRRADVRLRA
AAAR
NT seq 375 nt   +upstreamnt  +downstreamnt
ttggctgctgagctgcacgtcgcgctggtcgcggccgaccgagaggtctggtccggcgag
gccaccctggtcgtcgcgcgcaccacgtccggcgacatcggcgtcatgcccggtcaccag
ccgctgctcggtgtgctggagtcgggcccggtgaccatccgcaagagcgatggtggaacg
gtcgtcgccgcggtgcacggcggtttcatctcgttcgcggacaacaagctgtccctgctc
gccgagatcgccgagctgtcggacgagatcgacgtccagcgtgcccagcaggagctggag
cgcgcgaaggcggagggcgacgaagccgcccagcgccgcgcggacgtccgactgcgtgcg
gcggcggcgcgctga

DBGET integrated database retrieval system