Streptomyces gilvosporeus: B1H19_25820 Help Entry B1H19_25820       CDS       T05165                                  Name (GenBank) hypothetical protein   KO K27095   acyl-CoA carboxylase epsilon subunit Organism sgv  Streptomyces gilvosporeus Pathway sgv00074   Mycolic acid biosynthesis sgv00280   Valine, leucine and isoleucine degradation sgv00630   Glyoxylate and dicarboxylate metabolism sgv00640   Propanoate metabolism sgv01100   Metabolic pathways sgv01110   Biosynthesis of secondary metabolites sgv01120   Microbial metabolism in diverse environments sgv01200   Carbon metabolism Module sgv_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:sgv00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     B1H19_25820    00640 Propanoate metabolism     B1H19_25820   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     B1H19_25820   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     B1H19_25820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACC_epsilon Motif Other DBs NCBI-ProteinID:  ARF57130 UniProt:  A0A1V0TWC7 LinkDB All DBs Position complement(5761575..5761784) Genome browser AA seq 69 aa AA seqDB search MIKVVRGNPTPEELAAALAVVQARAAAAAAVVPGGPERGNEWSDPASTVPARRVPHPGPR AWRTSFWPH NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgatcaaggtcgtacggggcaacccgaccccggaggagctggccgccgcactggcggtg gtgcaggcccgcgcggcggccgccgctgccgtcgtgccgggagggccggaacgcggcaac gagtggtcggacccggcctccacggtcccggcccgccgggtgccgcatccgggaccgcgg gcctggcggaccagcttctggccgcactag

DBGET integrated database retrieval system