Streptomyces gardneri: H4W23_11715 Help Entry H4W23_11715       CDS       T07252                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism sgx  Streptomyces gardneri Pathway sgx00253   Tetracycline biosynthesis sgx01056   Biosynthesis of type II polyketide backbone sgx01100   Metabolic pathways sgx01110   Biosynthesis of secondary metabolites Module sgx_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:sgx00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     H4W23_11715    00253 Tetracycline biosynthesis     H4W23_11715  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:sgx01004]     H4W23_11715    01008 Polyketide biosynthesis proteins [BR:sgx01008]     H4W23_11715 Lipid biosynthesis proteins [BR:sgx01004]  Polyketide synthase   Component type    H4W23_11715 Polyketide biosynthesis proteins [BR:sgx01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      H4W23_11715     Nonaketide PKS      H4W23_11715     Decaketide PKS      H4W23_11715 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QPK45238 LinkDB All DBs Position complement(2612251..2612514) Genome browser AA seq 87 aa AA seqDB search MARLTLDTLLQILRECAGEEEGVDLGGDILDTPFVELGYDSLALLQATGRIERDFGVALP DDVVAEAETPALLLGLVNGAEAVPVAA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggcccggctgacgcttgacaccctcttgcagatcctccgtgagtgcgcgggcgaggag gagggcgtggacctggggggcgacatcctcgacaccccgttcgtggagctcggttacgac tcgctggccctgctccaggcgaccggccgcatcgagcgggacttcggggtcgccctgccc gacgacgtcgtggcggaggcggagacgccggccctcctcctcggcctggtcaacggcgcg gaggccgtaccggtcgccgcctga

DBGET integrated database retrieval system