Streptomyces gardneri: H4W23_35895 Help Entry H4W23_35895       CDS       T07252                                  Name (GenBank) acyl carrier protein   KO K16025   methoxymalonate biosynthesis acyl carrier protein Organism sgx  Streptomyces gardneri Pathway sgx01051   Biosynthesis of ansamycins sgx01052   Type I polyketide structures Brite KEGG Orthology (KO) [BR:sgx00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01052 Type I polyketide structures     H4W23_35895    01051 Biosynthesis of ansamycins     H4W23_35895  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sgx01008]     H4W23_35895 Polyketide biosynthesis proteins [BR:sgx01008]  Polyketide tailoring proteins   Others    H4W23_35895 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QPK49458 LinkDB All DBs Position 7935903..7936199 Genome browser AA seq 98 aa AA seqDB search MTPEQQTEKAPFDTDAVVDEITRFVAKQTRTSPEADQDLFATGVANSMFAMQLVVFLEQA YAVTVAGPDLQLSNFRTVKSMAALVGRLQADAAADSDV NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaccccggaacagcagaccgagaaggcgcccttcgacacggacgccgtcgtcgacgag atcaccaggttcgtggccaagcagacccggaccagccccgaggcggaccaggacctcttc gccacaggggtcgccaattccatgttcgccatgcagctggtcgtgttcctggaacaggcc tacgccgtgacggtcgccggaccggacctgcagctgtccaacttccgcacggtcaagagc atggccgcgctcgtcgggcgactccaggcagacgctgccgcagacagcgatgtctga

DBGET integrated database retrieval system