Streptomyces globosus: C0216_26770 Help Entry C0216_26770       CDS       T06864                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism sgz  Streptomyces globosus Brite KEGG Orthology (KO) [BR:sgz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sgz03032]     C0216_26770    03036 Chromosome and associated proteins [BR:sgz03036]     C0216_26770    03400 DNA repair and recombination proteins [BR:sgz03400]     C0216_26770 DNA replication proteins [BR:sgz03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     C0216_26770 Chromosome and associated proteins [BR:sgz03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     C0216_26770 DNA repair and recombination proteins [BR:sgz03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       C0216_26770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding Urease_beta HU-HIG A_thal_3526 Major_capside Motif Other DBs NCBI-ProteinID:  AXE26562 UniProt:  A0A344U6P1 LinkDB All DBs Position complement(6026265..6026546) Genome browser AA seq 93 aa AA seqDB search MNRSELVAALSERAEVTRKDADAVLAALAETVGEIVAKGDEKVTIPGFLTFERTHRAART ARNPQTGDPIQIPAGYSVKVSAGSKLKEAAKGK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcagtgagctggtggccgctctgtccgagcgcgccgaggtgacccgcaaggac gccgacgccgttctggccgcgctcgccgagaccgtcggcgagatcgtcgccaagggcgac gagaaggtcaccatccccggcttcctgaccttcgagcgcacccaccgtgccgctcgcacc gcgcgcaacccgcagaccggcgacccgatccagatcccggccggctacagcgtgaaggtc tccgcgggctccaagctcaaggaagccgccaagggcaagtaa

DBGET integrated database retrieval system