Streptomyces globosus: C0216_31585 Help Entry C0216_31585       CDS       T06864                                  Name (GenBank) hypothetical protein   KO K03746   DNA-binding protein H-NS Organism sgz  Streptomyces globosus Brite KEGG Orthology (KO) [BR:sgz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sgz03036]     C0216_31585    03400 DNA repair and recombination proteins [BR:sgz03400]     C0216_31585 Chromosome and associated proteins [BR:sgz03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     C0216_31585 DNA repair and recombination proteins [BR:sgz03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       C0216_31585 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  AXE28047 UniProt:  A0A344UAX6 LinkDB All DBs Position unnamed2:136326..136511 Genome browser AA seq 61 aa AA seqDB search MCGCRPTEQDGHRERRRGVGPRGATDVRPRSGPLPSGAPPVVRDESASSGSWCGSGEPPG K NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgtgcggatgccgccccacggaacaggatggacaccgcgaacgccgcaggggtgtcggg ccccggggtgcgacagacgtgcgcccgcgctcgggaccgctgccttcgggggctcctcct gtcgttcgcgacgagtcggcgtcgtccggttcgtggtgcggttcgggtgagccgcccggc aaatga

DBGET integrated database retrieval system