Strigops habroptila (Kakapo): 115602910 Help Entry 115602910         CDS       T08851                                  Symbol BAX Name (RefSeq) apoptosis regulator BAX   KO K02159   apoptosis regulator BAX Organism shab  Strigops habroptila (Kakapo) Pathway shab04115   p53 signaling pathway shab04141   Protein processing in endoplasmic reticulum shab04210   Apoptosis shab04217   Necroptosis shab05132   Salmonella infection shab05164   Influenza A shab05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:shab00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     115602910 (BAX)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     115602910 (BAX)    04217 Necroptosis     115602910 (BAX)    04115 p53 signaling pathway     115602910 (BAX)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     115602910 (BAX)    05168 Herpes simplex virus 1 infection     115602910 (BAX)   09171 Infectious disease: bacterial    05132 Salmonella infection     115602910 (BAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:shab03029]     115602910 (BAX)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:shab02000]     115602910 (BAX) Mitochondrial biogenesis [BR:shab03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Fission and Fusion factors     115602910 (BAX) Transporters [BR:shab02000]  Other transporters   Pores ion channels [TC:1]    115602910 (BAX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 PMAIP1 Motif Other DBs NCBI-GeneID:  115602910 NCBI-ProteinID:  XP_030330214 LinkDB All DBs Position Unknown AA seq 188 aa AA seqDB search MRTGALLLRGFIRDRVERCGDAAALALGRAELGAEPEAEPGPGPGPGRAQPDTKRLSECL RRIGDELDRNAELQRMIADVGCEAPKELFFKVATEMFSDGTFNWGRVVALFYFACKLVLK ALCAKVPELVRTILGWTMEYLREHVLGWIQAQGGWDGLLSSSVTPSWQTVTIFVAGVLTT SLTIWKMS NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgaggacgggggcgctgctgctgcgggggttcatccgggaccgcgtggagcgctgcggg gacgcggccgcgctcgccctgggccgggcggagctgggggcggagccggaggcggagccg gggccggggccggggccgggccgggcccagcccgacacgaagcggctcagcgagtgcctg cggcgcatcggggacgagctggaccgcaacgcggagctgcagcggatgatcgcagatgtg gggtgcgaggcccccaaggagctcttcttcaaggtggccactgagatgttctccgacggc accttcaactggggccgcgtcgtcgccctcttctatttcgcctgcaaactggtgctcaaa gcgctctgtgccaaggtcccggagctggttcggaccatcctgggctggaccatggagtac ctgagggagcacgtgctgggctggatccaggcgcagggaggatgggacgggctcctgtcg tcctcggtcaccccctcctggcagactgtcaccatcttcgttgcgggggtgctcaccacg tccctcaccatatggaagatgtcctag

DBGET integrated database retrieval system