Strigops habroptila (Kakapo): 115603141 Help Entry 115603141         CDS       T08851                                  Name (RefSeq) C-C motif chemokine 4 homolog   KO K12964   C-C motif chemokine 4 Organism shab  Strigops habroptila (Kakapo) Pathway shab04060   Cytokine-cytokine receptor interaction shab04620   Toll-like receptor signaling pathway shab04623   Cytosolic DNA-sensing pathway Brite KEGG Orthology (KO) [BR:shab00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     115603141  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     115603141    04623 Cytosolic DNA-sensing pathway     115603141  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shab04052]     115603141 Cytokines and neuropeptides [BR:shab04052]  Cytokines   Chemokines    115603141 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  115603141 NCBI-ProteinID:  XP_030330687 UniProt:  A0A672UM98 LinkDB All DBs Position 13:558623..560040 Genome browser AA seq 90 aa AA seqDB search MKVSVAALAILIAAFCYQTSAAPIGSDPPTSCCFTYISRQLPRSFVVEYYETSSQCPQPA VVFVTKKGRQVCANPDQEWVQEYRNELELQ NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctctgtggctgcccttgccattctcattgctgccttctgctaccagacctct gctgcaccaattggctctgacccaccaacctcctgctgcttcacctacatctcccggcaa ctgccccgcagcttcgtggtggaatactatgagaccagcagccagtgcccccagccagca gtcgtgtttgtcacaaagaagggtcgccaagtctgcgccaaccctgatcaggagtgggtc caggagtacaggaatgaactggagctgcagtaa

DBGET integrated database retrieval system