Strigops habroptila (Kakapo): 115603411 Help Entry 115603411         CDS       T08851                                  Symbol UBL5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism shab  Strigops habroptila (Kakapo) Brite KEGG Orthology (KO) [BR:shab00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:shab03041]     115603411 (UBL5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shab04052]     115603411 (UBL5) Spliceosome [BR:shab03041]  Complex B   Other components    Complex B specific factors     115603411 (UBL5) Cytokines and neuropeptides [BR:shab04052]  Neuropeptides   Unclassified    115603411 (UBL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 DUF5343 Motif Other DBs NCBI-GeneID:  115603411 NCBI-ProteinID:  XP_030331117 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNTEDSIRDLKKLIAAQTGTRWDKIVLKKWYTIFKDHVTLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaagtcgtctgcaacgaccgtctgggcaagaaggtgcgggtgaaatgcaacacc gaggactcgatccgcgacctgaagaagctgatcgcggcgcagaccgggacccgctgggat aagatcgtgctcaagaagtggtacactatcttcaaggatcacgtcacgctgggcgactat gagatccatgacggcatgaacctggagctctactaccagtag

DBGET integrated database retrieval system