Strigops habroptila (Kakapo): 115604785 Help Entry 115604785         CDS       T08851                                  Symbol DNAL4 Name (RefSeq) dynein light chain 4, axonemal   KO K10412   dynein axonemal light chain 4 Organism shab  Strigops habroptila (Kakapo) Pathway shab04814   Motor proteins Brite KEGG Orthology (KO) [BR:shab00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     115604785 (DNAL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:shab03037]     115604785 (DNAL4)    04812 Cytoskeleton proteins [BR:shab04812]     115604785 (DNAL4) Cilium and associated proteins [BR:shab03037]  Motile cilia and associated proteins   Dynein arm    115604785 (DNAL4) Cytoskeleton proteins [BR:shab04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      115604785 (DNAL4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light DUF6935 Motif Other DBs NCBI-GeneID:  115604785 NCBI-ProteinID:  XP_030334049 UniProt:  A0A672TI98 LinkDB All DBs Position 3:complement(76249352..76254240) Genome browser AA seq 106 aa AA seqDB search MADTGEGKKEEAEYKRLHTFPLIRHTDMPEEMRVEAMELCVTACEKYATNNESAAKMIKE TMDKKFGSSWHVVIGEGFGFEITHEVKNLLYMFFGGSLAVCVWKCS NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggcagacaccggggaggggaaaaaggaggaggctgaatataaaagacttcacaccttt ccactgatcaggcacacagacatgccggaggagatgcgtgtagaggccatggagctgtgt gtcacggcgtgtgagaaatacgccaccaacaacgagagtgctgccaagatgatcaaagag acgatggacaagaaatttgggtcctcctggcatgtggtgattggggaaggttttggcttt gagatcactcacgaggtgaagaatctgctttacatgttctttggtggcagcctggctgtg tgtgtctggaagtgctcctga

DBGET integrated database retrieval system